GLP-1(7-36) amide vs Exendin-4
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Exendin-4 (Exendin-4 (synthetic exenatide)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Exendin-4 |
|---|---|---|
| Category | Endocrine Peptides | Diabetes & Metabolic |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Exendin-4 (synthetic exenatide) |
| Molecular Weight | 3297.7 Da | 4186 Da |
| Half-Life | 1-2 min | 2.4 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 39 |
| Typical Dose | pM-nM physiologic range|research-dependent | 5-10 mcg twice daily |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 1800 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Exendin-4 Benefits
- ✓beta-cell survival
- ✓glucose-stimulated insulin secretion
- ✓reduced glucolipotoxicity
- ✓lowered HbA1c in clinical use
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Exendin-4 Dosing
5 mcg SC twice daily for 4 weeks|increase to 10 mcg SC twice daily if tolerated|research: 0.1-1 µM in vitro or 1-10 µg/kg in animals
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Exendin-4 Side Effects
- ⚠nausea
- ⚠vomiting
- ⚠injection-site reactions
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Exendin-4
Exendin-4 helped establish GLP-1 receptor biology in diabetes and remains a classic beta-cell protective peptide. Preclinical studies show reduced beta-cell apoptosis, improved insulin content, and better islet function under metabolic stress.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.