GLP-1(7-36) amide vs Insulin Aspart
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Insulin Aspart (Insulin aspart (B28-Asp human insulin analog)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Insulin Aspart |
|---|---|---|
| Category | Endocrine Peptides | Diabetes & Metabolic |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Insulin aspart (B28-Asp human insulin analog) |
| Molecular Weight | 3297.7 Da | 5825.8 Da |
| Half-Life | 1-2 min | About 1-3 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 51 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.05-0.2 U/kg per meal |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 11000 |
| Research Status | Endogenous | Approved |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Insulin Aspart Benefits
- ✓Fast post-meal glucose lowering
- ✓Predictable onset
- ✓Flexible mealtime administration
- ✓Compatible with pump therapy
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Insulin Aspart Dosing
Inject SC immediately before meals|Titrate using glucose monitoring and carbohydrate intake|Can be used in insulin pumps or basal-bolus regimens
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Insulin Aspart Side Effects
- ⚠Hypoglycemia
- ⚠Injection-site reactions
- ⚠Weight gain
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Insulin Aspart
Research consistently shows faster onset and earlier peak action than regular human insulin. It is commonly studied for meal-time glycemic control and pump-based insulin delivery.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.