GLP-1(7-36) amide vs Insulin Glargine
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Insulin Glargine (Insulin glargine (A21Gly,B31Arg,B32Arg human insulin analog)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Insulin Glargine |
|---|---|---|
| Category | Endocrine Peptides | Diabetes & Metabolic |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Insulin glargine (A21Gly,B31Arg,B32Arg human insulin analog) |
| Molecular Weight | 3297.7 Da | 6063.6 Da |
| Half-Life | 1-2 min | About 12-24 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 51 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.1-0.2 U/kg once daily |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 13000 |
| Research Status | Endogenous | Approved |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Insulin Glargine Benefits
- ✓Once-daily basal coverage
- ✓Smooth action profile
- ✓Lower nocturnal hypoglycemia risk
- ✓Improves fasting glucose control
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Insulin Glargine Dosing
Inject SC once daily at the same time each day|Titrate every 3-4 days to fasting glucose targets|Can be combined with prandial insulin
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Insulin Glargine Side Effects
- ⚠Hypoglycemia
- ⚠Injection-site reactions
- ⚠Weight gain
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Insulin Glargine
Clinical and translational studies support its use as a basal comparator because of prolonged absorption and stable glycemic control. It is heavily used in basal-bolus regimen research and insulin-delivery optimization studies.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.