GLP-1(7-36) amide vs Insulin Lispro
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Insulin Lispro (Insulin lispro (B28-Lys, B29-Pro human insulin analog)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Insulin Lispro |
|---|---|---|
| Category | Endocrine Peptides | Diabetes & Metabolic |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Insulin lispro (B28-Lys, B29-Pro human insulin analog) |
| Molecular Weight | 3297.7 Da | 5808.0 Da |
| Half-Life | 1-2 min | About 1 hour |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 51 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.05-0.2 U/kg per meal |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 12000 |
| Research Status | Endogenous | Approved |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Insulin Lispro Benefits
- ✓Rapid postprandial glucose control
- ✓Flexible premeal timing
- ✓Predictable onset of action
- ✓Useful in basal-bolus regimens
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Insulin Lispro Dosing
Inject SC 0-15 minutes before meals|Adjust dose to carbohydrate intake and premeal glucose|Often paired with a basal insulin
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Insulin Lispro Side Effects
- ⚠Hypoglycemia
- ⚠Weight gain
- ⚠Injection-site reactions
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Insulin Lispro
Clinical studies show faster onset and shorter duration than regular insulin, improving post-meal glucose control. It is a standard comparator in diabetes pharmacology and closed-loop insulin-delivery research.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.