GLP-1(7-36) amide vs Cetrorelix
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Cetrorelix (Cetrorelix acetate) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Cetrorelix |
|---|---|---|
| Category | Endocrine Peptides | Sexual Health |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Cetrorelix acetate |
| Molecular Weight | 3297.7 Da | 1431.06 Da |
| Half-Life | 1-2 min | ~30 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 10 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.25 mg SC daily |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 300 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Cetrorelix Benefits
- ✓prevents premature ovulation
- ✓supports IVF cycle control
- ✓blocks LH surge
- ✓short-acting pituitary suppression
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Cetrorelix Dosing
0.25 mg SC daily|start on stimulation day 5-6|protocol-dependent antagonist cycle
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Cetrorelix Side Effects
- ⚠injection-site reactions
- ⚠headache
- ⚠nausea
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Cetrorelix
Cetrorelix is a cornerstone GnRH antagonist in assisted reproduction, with a fast onset and reversible suppression of LH. Trials show it improves cycle management by reducing premature ovulation during stimulation.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.