GLP-1(7-36) amide vs Kisspeptin-54
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Kisspeptin-54 (Kisspeptin-54 (metastin), 54-amino-acid KISS1 peptide fragment) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Kisspeptin-54 |
|---|---|---|
| Category | Endocrine Peptides | Sexual Health |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Kisspeptin-54 (metastin), 54-amino-acid KISS1 peptide fragment |
| Molecular Weight | 3297.7 Da | 5.9 kDa |
| Half-Life | 1-2 min | about 20-30 min |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 54 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.3-1.0 nmol/kg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intravenous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 110 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Kisspeptin-54 Benefits
- ✓GnRH/LH stimulation
- ✓supports sex hormone signaling
- ✓may enhance sexual motivation
- ✓fertility-axis modulation
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Kisspeptin-54 Dosing
0.3-1.0 nmol/kg IV bolus|single-dose experimental protocols|research-only endocrine monitoring
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Kisspeptin-54 Side Effects
- ⚠flushing
- ⚠nausea
- ⚠headache
- ⚠hormonal shifts
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Kisspeptin-54
Human studies show that kisspeptin-54 can acutely modulate reproductive neuroendocrine signaling, which makes it relevant to libido and sexual motivation research. Its effects are indirect compared with PT-141, but it is a well-established peptide in the scientific literature.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.