GLP-1(7-36) amide vs Kisspeptin-52
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Kisspeptin-52 (Kisspeptin-52 (KISS1-derived peptide fragment)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Kisspeptin-52 |
|---|---|---|
| Category | Endocrine Peptides | Sexual Health |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Kisspeptin-52 (KISS1-derived peptide fragment) |
| Molecular Weight | 3297.7 Da | ≈5,800 Da |
| Half-Life | 1-2 min | Minutes to ~1 hour |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 52 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.1-3.0 nmol/kg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intravenous/Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 120 |
| Research Status | Endogenous | Clinical research |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Kisspeptin-52 Benefits
- ✓stimulates GnRH signaling
- ✓supports LH/FSH release
- ✓aids ovulation research
- ✓maps reproductive-axis function
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Kisspeptin-52 Dosing
0.1-3.0 nmol/kg IV bolus|0.1-1.0 nmol/kg SC|protocol-dependent infusion
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Kisspeptin-52 Side Effects
- ⚠flushing
- ⚠nausea
- ⚠headache
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Kisspeptin-52
Human and animal studies show kisspeptin-52 can acutely increase gonadotropin secretion and activate the hypothalamic-pituitary-gonadal axis. It has been explored in fertility research and assisted-reproduction settings as a way to trigger endogenous reproductive hormone release.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.