GLP-1(7-36) amide vs Leuprolide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Leuprolide (Leuprolide acetate) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Leuprolide |
|---|---|---|
| Category | Endocrine Peptides | Sexual Health |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Leuprolide acetate |
| Molecular Weight | 3297.7 Da | 1209.39 Da |
| Half-Life | 1-2 min | ~3 hours; depot lasts weeks |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 9 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.1 mg SC daily|3.75 mg IM monthly|11.25 mg depot per protocol |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous/Intramuscular |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 1200 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Leuprolide Benefits
- ✓pituitary suppression
- ✓cycle synchronization
- ✓ovarian stimulation timing
- ✓endometriosis-related reproductive care
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Leuprolide Dosing
0.1 mg SC daily|3.75 mg IM monthly depot|11.25 mg 3-month depot
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Leuprolide Side Effects
- ⚠hot flashes
- ⚠decreased libido
- ⚠injection-site reactions
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Leuprolide
Leuprolide is one of the best-studied GnRH analogs in reproductive medicine and assisted reproduction. It produces an initial flare followed by receptor desensitization and reduced LH/FSH output.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.