GLP-1(7-36) amide vs Buserelin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Buserelin (Buserelin acetate) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Buserelin |
|---|---|---|
| Category | Endocrine Peptides | Sexual Health |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Buserelin acetate |
| Molecular Weight | 3297.7 Da | 1239.39 Da |
| Half-Life | 1-2 min | ~50-80 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 9 |
| Typical Dose | pM-nM physiologic range|research-dependent | 200 mcg intranasal 3x daily|0.2-0.5 mg SC daily|depot per protocol |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intranasal/Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 450 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Buserelin Benefits
- ✓pituitary down-regulation
- ✓cycle synchronization
- ✓ovarian stimulation control
- ✓fertility protocol timing
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Buserelin Dosing
200 mcg intranasal 3x daily|0.2-0.5 mg SC daily|depot injection per protocol
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Buserelin Side Effects
- ⚠hot flashes
- ⚠headache
- ⚠initial LH/FSH flare
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Buserelin
Buserelin has been studied extensively as a GnRH agonist in IVF down-regulation and other reproductive-endocrine protocols. Its use helped establish modern cycle-control approaches in assisted reproduction.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.