5-Amino-1MQ vs GLP-1(7-36) amide
Head-to-head comparison of 5-Amino-1MQ (5-Amino-1-methylquinolinium) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | 5-Amino-1MQ | GLP-1(7-36) amide |
|---|---|---|
| Category | Weight Management | Endocrine Peptides |
| Full Name | 5-Amino-1-methylquinolinium | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 178.23 g/mol | 3297.7 Da |
| Half-Life | ~6 hours | 1-2 min |
| Amino Acids | Small molecule | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | — | pM-nM physiologic range|research-dependent |
| Route | — | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | >98% | ≥98% |
| Studies Count | 28 | 99 |
| Research Status | Active Research | Endogenous |
5-Amino-1MQ Benefits
- ✓Reduces body fat without appetite changes, lowers cholesterol, increases NAD+ levels, improves metabolic efficiency, supports cellular energy production
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
5-Amino-1MQ Dosing
Research doses: 50-150 mg orally daily. Often cycled 8-12 weeks on, 4 weeks off. Best taken in the morning.
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
5-Amino-1MQ Side Effects
- ⚠Generally well-tolerated in preclinical models. Potential mild GI discomfort and headache. Long-term human safety data is limited.
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
5-Amino-1MQ
Studies in diet-induced obese mice showed significant reductions in body weight, white adipose tissue mass, and cholesterol levels without changes in food intake. Works by inhibiting NNMT enzyme to increase NAD+ and activate sirtuins.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.