Plecanatide vs GLP-1(7-36) amide
Head-to-head comparison of Plecanatide (Plecanatide) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Plecanatide | GLP-1(7-36) amide |
|---|---|---|
| Category | Gastrointestinal | Endocrine Peptides |
| Full Name | Plecanatide | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | Approx. 1620 Da | 3297.7 Da |
| Half-Life | Local intestinal action; systemic half-life not clinically meaningful | 1-2 min |
| Amino Acids | 16 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | 3 mg once daily | pM-nM physiologic range|research-dependent |
| Route | Oral | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 350 | 99 |
| Research Status | Clinical | Endogenous |
Plecanatide Benefits
- ✓improves-stool-frequency
- ✓supports-fluid-secretion
- ✓may-reduce-constipation
- ✓local-gut-action
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Plecanatide Dosing
3 mg PO daily|take with or without food|avoid when dehydrated
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Plecanatide Side Effects
- ⚠diarrhea
- ⚠abdominal-discomfort
- ⚠nausea
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
Plecanatide
Clinical trials show plecanatide improves constipation outcomes with a generally favorable tolerability profile. Like linaclotide, it acts locally in the intestinal lumen via GC-C signaling rather than systemic hormone effects.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.