Neuropeptide S vs GLP-1(7-36) amide
Head-to-head comparison of Neuropeptide S (Neuropeptide S) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Neuropeptide S | GLP-1(7-36) amide |
|---|---|---|
| Category | Cognitive Enhancement | Endocrine Peptides |
| Full Name | Neuropeptide S | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 2203 Da | 3297.7 Da |
| Half-Life | Minutes to <1 hour | 1-2 min |
| Amino Acids | 20 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | Research-only; no validated human dose | pM-nM physiologic range|research-dependent |
| Route | Intracerebroventricular/Intranasal | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 28 | 99 |
| Research Status | Pre-clinical | Endogenous |
Neuropeptide S Benefits
- ✓anxiolysis
- ✓stress resilience
- ✓attention support
- ✓arousal modulation
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Neuropeptide S Dosing
0.1-1 nmol i.c.v. in animal studies|intranasal research-only exploration|no established human protocol
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Neuropeptide S Side Effects
- ⚠sleep disruption
- ⚠headache
- ⚠jitteriness
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
Neuropeptide S
Animal studies suggest NPS can reduce anxiety-like behavior while altering wakefulness and alertness through the NPS receptor system. Human cognitive data are very limited, and it has no approved clinical indication.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.