GLP-1(7-36) amide vs NPY
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and NPY (Neuropeptide Y) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | NPY |
|---|---|---|
| Category | Endocrine Peptides | Cognitive Enhancement |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Neuropeptide Y |
| Molecular Weight | 3297.7 Da | 4272 Da |
| Half-Life | 1-2 min | minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 36 aa |
| Typical Dose | pM-nM physiologic range|research-dependent | 1-10 µg preclinical range |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intranasal |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 900 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
NPY Benefits
- ✓stress resilience
- ✓hippocampal protection
- ✓memory modulation
- ✓anti-excitotoxic signaling
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
NPY Dosing
0.1-1 nmol ICV in rodents|1-10 µg intranasal in experimental work|acute or repeated stress-model protocols
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
NPY Side Effects
- ⚠sedation
- ⚠appetite increase
- ⚠blood pressure changes
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
NPY
NPY has been shown in animal studies to protect neurons from excitotoxic injury and to dampen stress-linked cognitive impairment. It is often discussed as a counterbalance to overactive glutamatergic and stress pathways in the brain.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.