GLP-1(7-36) amide vs Arginine Vasopressin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Arginine Vasopressin (8-Arginine Vasopressin) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Arginine Vasopressin |
|---|---|---|
| Category | Endocrine Peptides | Cognitive Enhancement |
| Full Name | Glucagon-like peptide-1 (7-36) amide | 8-Arginine Vasopressin |
| Molecular Weight | 3297.7 Da | 1084.23 Da |
| Half-Life | 1-2 min | 10-20 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 9 |
| Typical Dose | pM-nM physiologic range|research-dependent | 10-40 IU intranasal research range |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intranasal/Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 100 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Arginine Vasopressin Benefits
- ✓memory consolidation
- ✓recall support
- ✓arousal-linked learning
- ✓social cognition
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Arginine Vasopressin Dosing
intranasal research dosing|10-40 IU per dose in studies|single or repeated administration
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Arginine Vasopressin Side Effects
- ⚠blood pressure elevation
- ⚠headache
- ⚠hyponatremia
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Arginine Vasopressin
Animal and human studies indicate vasopressin can modulate hippocampal and limbic circuits involved in learning and memory. The effect size is context dependent, and results vary by dose, route, and baseline cognitive state.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.