GLP-1(7-36) amide vs Noopept
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Noopept (N-phenylacetyl-L-prolylglycine ethyl ester) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Noopept |
|---|---|---|
| Category | Endocrine Peptides | Cognitive Enhancement |
| Full Name | Glucagon-like peptide-1 (7-36) amide | N-phenylacetyl-L-prolylglycine ethyl ester |
| Molecular Weight | 3297.7 Da | 318.37 Da |
| Half-Life | 1-2 min | 20-30 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 10-30 mg/day |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Oral |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 60 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Noopept Benefits
- ✓memory recall
- ✓learning efficiency
- ✓attention support
- ✓neurotrophic signaling
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Noopept Dosing
oral research use|10-30 mg per day in human studies|divided or single daily dosing
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Noopept Side Effects
- ⚠headache
- ⚠irritability
- ⚠sleep disturbance
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Noopept
Noopept has been reported to increase NGF/BDNF-related signaling and improve performance in tasks involving learning and recall. Evidence includes preclinical studies and small human studies, but the overall literature is still modest compared with mainstream cognitive drugs.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.