GLP-1(7-36) amide vs Davunetide
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Davunetide (Activity-Dependent Neuroprotective Protein fragment NAP (NAPVSIPQ)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Davunetide |
|---|---|---|
| Category | Endocrine Peptides | Cognitive Enhancement |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Activity-Dependent Neuroprotective Protein fragment NAP (NAPVSIPQ) |
| Molecular Weight | 3297.7 Da | 796.9 Da |
| Half-Life | 1-2 min | short; minutes to low hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 8 |
| Typical Dose | pM-nM physiologic range|research-dependent | 1-10 mg/day research range |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intranasal |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 40 |
| Research Status | Endogenous | Clinical/Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Davunetide Benefits
- ✓neuroprotection
- ✓microtubule support
- ✓attention support
- ✓memory preservation
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Davunetide Dosing
intranasal research dosing|1-10 mg per dose in trials/preclinical work|once or twice daily
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Davunetide Side Effects
- ⚠nasal irritation
- ⚠headache
- ⚠limited efficacy in late-stage trials
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Davunetide
Preclinical work showed davunetide can protect neurons, preserve synaptic structure, and improve performance in memory tasks. Human trials largely focused on neurodegenerative disease outcomes rather than stand-alone nootropic use, but the literature supports CNS activity.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.