GLP-1(7-36) amide vs Desmopressin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Desmopressin (1-Deamino-8-D-arginine vasopressin) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Desmopressin |
|---|---|---|
| Category | Endocrine Peptides | Cognitive Enhancement |
| Full Name | Glucagon-like peptide-1 (7-36) amide | 1-Deamino-8-D-arginine vasopressin |
| Molecular Weight | 3297.7 Da | 1069.22 Da |
| Half-Life | 1-2 min | 1.5-3 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 9 |
| Typical Dose | pM-nM physiologic range|research-dependent | 10-40 mcg intranasal |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intranasal/Oral |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 35 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Desmopressin Benefits
- ✓memory consolidation
- ✓reduced pressor burden
- ✓recall support
- ✓short-term learning
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Desmopressin Dosing
intranasal research dosing|10-40 mcg or IU-equivalent studies|single-dose protocols
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Desmopressin Side Effects
- ⚠hyponatremia
- ⚠headache
- ⚠nasal irritation
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Desmopressin
The literature is mixed, but desmopressin has shown memory-related effects in selected populations and experimental paradigms. Its cognitive effects are usually discussed as a vasopressin-pathway probe rather than a primary nootropic.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.