GLP-1(7-36) amide vs GPE
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and GPE (Glycyl-L-prolyl-L-glutamic acid) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | GPE |
|---|---|---|
| Category | Endocrine Peptides | Cognitive Enhancement |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Glycyl-L-prolyl-L-glutamic acid |
| Molecular Weight | 3297.7 Da | 301.30 Da |
| Half-Life | 1-2 min | minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 3 |
| Typical Dose | pM-nM physiologic range|research-dependent | 0.1-10 mg/kg preclinical |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intranasal/Intracerebroventricular |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 25 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
GPE Benefits
- ✓memory consolidation
- ✓neuroprotection
- ✓synaptic plasticity
- ✓learning support
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
GPE Dosing
intranasal or ICV research doses|0.1-10 mg/kg preclinical range|repeat daily or intermittent protocols
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
GPE Side Effects
- ⚠limited human safety data
- ⚠short half-life
- ⚠local irritation with nasal delivery
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
GPE
Preclinical studies suggest GPE can reduce neuronal damage and support plasticity-related pathways in the brain. Research interest centers on hippocampal function, which links it to learning and memory paradigms.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.