GLP-1(7-36) amide vs PACAP-38
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and PACAP-38 (Pituitary Adenylate Cyclase-Activating Polypeptide-38 (human PACAP-38)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | PACAP-38 |
|---|---|---|
| Category | Endocrine Peptides | Cognitive Enhancement |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Pituitary Adenylate Cyclase-Activating Polypeptide-38 (human PACAP-38) |
| Molecular Weight | 3297.7 Da | 4534 Da |
| Half-Life | 1-2 min | minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 38 aa |
| Typical Dose | pM-nM physiologic range|research-dependent | 10-100 µg preclinical range |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intranasal |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 650 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
PACAP-38 Benefits
- ✓synaptic plasticity
- ✓BDNF upregulation
- ✓neuroprotection
- ✓memory consolidation
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
PACAP-38 Dosing
0.1-1 nmol ICV in rodents|10-100 µg intranasal in preclinical studies|single-dose or short repeated protocols
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
PACAP-38 Side Effects
- ⚠headache-like effects
- ⚠flushing
- ⚠hypotension
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
PACAP-38
PACAP-38 is one of the most studied endogenous neuropeptides for protecting neurons from ischemic and excitotoxic damage. Preclinical literature also links it to hippocampal plasticity and learning-related signaling, including increased BDNF expression.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.