GLP-1(7-36) amide vs NGF
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and NGF (Beta-Nerve Growth Factor (human NGF beta)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | NGF |
|---|---|---|
| Category | Endocrine Peptides | Cognitive Enhancement |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Beta-Nerve Growth Factor (human NGF beta) |
| Molecular Weight | 3297.7 Da | 13,600 Da |
| Half-Life | 1-2 min | hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 118 aa |
| Typical Dose | pM-nM physiologic range|research-dependent | research-only microgram range |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intranasal |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 3500 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
NGF Benefits
- ✓neurite outgrowth
- ✓cholinergic support
- ✓nerve repair
- ✓neuroprotection
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
NGF Dosing
0.01-1 µg/kg in experimental delivery studies|local CNS or intranasal research delivery|single or repeated low-dose protocols
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
NGF Side Effects
- ⚠pain at injection site
- ⚠hyperalgesia
- ⚠autonomic effects
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
NGF
NGF is one of the most established growth factors in neurobiology and has been investigated for both central and peripheral neuronal repair. Its strongest cognitive relevance comes from supporting basal forebrain cholinergic neurons and downstream memory circuitry.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.