IGF-1 DES vs GLP-1(7-36) amide
Head-to-head comparison of IGF-1 DES (Des(1-3) Insulin-like Growth Factor 1) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | IGF-1 DES | GLP-1(7-36) amide |
|---|---|---|
| Category | Growth Hormone | Endocrine Peptides |
| Full Name | Des(1-3) Insulin-like Growth Factor 1 | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 7365 Da | 3297.7 Da |
| Half-Life | ~20-30 minutes | 1-2 min |
| Amino Acids | 67 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | — | pM-nM physiologic range|research-dependent |
| Route | — | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | >98% | ≥98% |
| Studies Count | 65 | 99 |
| Research Status | Active Research | Endogenous |
IGF-1 DES Benefits
- ✓Highly potent localized muscle growth, enhanced protein synthesis, satellite cell proliferation, does not bind to IGFBPs, rapid onset
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
IGF-1 DES Dosing
50-150 mcg per injection site bilaterally post-workout. 4-6 week cycles due to potency. Multiple daily injections in research.
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
IGF-1 DES Side Effects
- ⚠Hypoglycemia (dose-dependent), localized swelling, shorter duration limits systemic exposure compared to IGF-1 LR3.
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
IGF-1 DES
Missing first three amino acids (Gly-Pro-Glu) eliminates IGFBP binding, resulting in 100% bioavailable IGF-1R stimulation. Activates PI3K/Akt/mTOR for protein synthesis and satellite cell proliferation.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.