HGH Fragment 176-191 vs GLP-1(7-36) amide
Head-to-head comparison of HGH Fragment 176-191 (Human Growth Hormone Fragment 176-191) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | HGH Fragment 176-191 | GLP-1(7-36) amide |
|---|---|---|
| Category | Weight Management | Endocrine Peptides |
| Full Name | Human Growth Hormone Fragment 176-191 | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 1817.12 g/mol | 3297.7 Da |
| Half-Life | ~30 minutes | 1-2 min |
| Amino Acids | 16 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | — | pM-nM physiologic range|research-dependent |
| Route | — | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | >98% | ≥98% |
| Studies Count | 45 | 99 |
| Research Status | Active Research | Endogenous |
HGH Fragment 176-191 Benefits
- ✓Targeted fat loss, no blood sugar impact, no IGF-1 elevation, inhibits lipogenesis, stimulates lipolysis, improved body composition
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
HGH Fragment 176-191 Dosing
250-500 mcg subcutaneously 1-2 times daily on empty stomach. 12-16 week cycles typical in research.
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
HGH Fragment 176-191 Side Effects
- ⚠Injection site irritation, headache, drowsiness. Does not affect blood sugar, insulin sensitivity, or elevate IGF-1.
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
HGH Fragment 176-191
This 16-amino-acid fragment specifically targets adipose tissue via beta-3 adrenergic receptors. Works through a GH-receptor-independent pathway, explaining selective fat-loss properties without growth-promoting effects.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.