HGH Fragment 176-191 vs GLP-1(7-36) amide

Head-to-head comparison of HGH Fragment 176-191 (Human Growth Hormone Fragment 176-191) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.

PropertyHGH Fragment 176-191GLP-1(7-36) amide
CategoryWeight ManagementEndocrine Peptides
Full NameHuman Growth Hormone Fragment 176-191Glucagon-like peptide-1 (7-36) amide
Molecular Weight1817.12 g/mol3297.7 Da
Half-Life~30 minutes1-2 min
Amino Acids16HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Typical DosepM-nM physiologic range|research-dependent
Routeendogenous secretion|SC/IV in research/clinical analog studies
Purity>98%≥98%
Studies Count4599
Research StatusActive ResearchEndogenous

HGH Fragment 176-191 Benefits

  • Targeted fat loss, no blood sugar impact, no IGF-1 elevation, inhibits lipogenesis, stimulates lipolysis, improved body composition

GLP-1(7-36) amide Benefits

  • glucose-dependent insulin secretion
  • gastric emptying delay
  • satiety signaling

HGH Fragment 176-191 Dosing

250-500 mcg subcutaneously 1-2 times daily on empty stomach. 12-16 week cycles typical in research.

GLP-1(7-36) amide Dosing

physiologic secretion|research-dependent

HGH Fragment 176-191 Side Effects

  • Injection site irritation, headache, drowsiness. Does not affect blood sugar, insulin sensitivity, or elevate IGF-1.

GLP-1(7-36) amide Side Effects

  • nausea
  • fullness
  • reduced appetite

Research Overview

HGH Fragment 176-191

This 16-amino-acid fragment specifically targets adipose tissue via beta-3 adrenergic receptors. Works through a GH-receptor-independent pathway, explaining selective fat-loss properties without growth-promoting effects.

GLP-1(7-36) amide

One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

HGH Fragment 176-191 stacks with:

AOD-9604CJC-1295Ipamorelin

GLP-1(7-36) amide stacks with:

L-cellsinsulinsatiety
fat-lossgrowth-hormone-fragmentlipolysisbody-recompositiongut-hormoneincretinendocrine-peptide