GLP-1(7-36) amide vs Nafarelin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Nafarelin (Nafarelin acetate) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Nafarelin |
|---|---|---|
| Category | Endocrine Peptides | Sexual Health |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Nafarelin acetate |
| Molecular Weight | 3297.7 Da | 1321.47 Da |
| Half-Life | 1-2 min | ~2-4 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 10 |
| Typical Dose | pM-nM physiologic range|research-dependent | 200 mcg intranasal twice daily |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intranasal |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 220 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Nafarelin Benefits
- ✓pituitary suppression
- ✓cycle scheduling
- ✓endometriosis-related reproductive care
- ✓controlled hormone modulation
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Nafarelin Dosing
200 mcg intranasal twice daily|0.4 mg/day intranasal|protocol-based suppression cycles
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Nafarelin Side Effects
- ⚠nasal irritation
- ⚠hot flashes
- ⚠headache
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Nafarelin
Nafarelin has a long history in reproductive medicine, especially for endometriosis and cycle suppression. Studies show it down-regulates the HPG axis after an initial stimulatory flare.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.