GLP-1(7-36) amide vs IGF-1 LR3
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and IGF-1 LR3 (Insulin-like Growth Factor-1 Long R3) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | IGF-1 LR3 |
|---|---|---|
| Category | Endocrine Peptides | Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Insulin-like Growth Factor-1 Long R3 |
| Molecular Weight | 3297.7 Da | 9,117 Da |
| Half-Life | 1-2 min | ~20-30 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 83 |
| Typical Dose | pM-nM physiologic range|research-dependent | 20-100 mcg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | IM / SC |
| Purity | ≥98% | — |
| Studies Count | 99 | 298 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
IGF-1 LR3 Benefits
- ✓Promotes muscle hyperplasia (new muscle cells)
- ✓Extended half-life vs native IGF-1
- ✓Enhanced protein synthesis
- ✓Improved nutrient partitioning
- ✓Anti-catabolic effects
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
IGF-1 LR3 Dosing
Standard: 20-50 mcg IM post-workout|Advanced: 50-100 mcg IM or SC daily|Cycle: 4-6 weeks on, 4 weeks off
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
IGF-1 LR3 Side Effects
- ⚠Common: Hypoglycemia (dose-dependent), joint pain, water retention
- ⚠Moderate: Gut growth concern (high doses), acromegaly-like symptoms
- ⚠Serious: Theoretical cancer risk (prolonged high-dose use)
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
IGF-1 LR3
IGF-1 LR3 has extensive in vitro and animal data. Its role in muscle hyperplasia is well-documented. The extended half-life modification provides practical advantages over native IGF-1.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.