GLP-1(7-36) amide vs GHRP-6
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and GHRP-6 (Growth Hormone Releasing Peptide-6) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | GHRP-6 |
|---|---|---|
| Category | Endocrine Peptides | Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Growth Hormone Releasing Peptide-6 |
| Molecular Weight | 3297.7 Da | 873.01 Da |
| Half-Life | 1-2 min | ~15-60 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 6 |
| Typical Dose | pM-nM physiologic range|research-dependent | 100-300 mcg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | SC / IV |
| Purity | ≥98% | — |
| Studies Count | 99 | 186 |
| Research Status | Endogenous | Clinical Trials |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
GHRP-6 Benefits
- ✓Potent GH release stimulation
- ✓Muscle growth and strength
- ✓Appetite stimulation (ghrelin pathway)
- ✓Improved body composition
- ✓Enhanced recovery from training
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
GHRP-6 Dosing
Standard: 100-300 mcg SC 2-3 times daily|Pre-workout: 100 mcg 30 min before training|Pre-bed: 100-200 mcg for overnight GH pulse
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
GHRP-6 Side Effects
- ⚠Common: Increased appetite (significant), water retention, tingling
- ⚠Moderate: Cortisol elevation (dose-dependent), lethargy
- ⚠Rare: Elevated prolactin at high doses
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
GHRP-6
GHRP-6 has solid pre-clinical and clinical evidence for GH stimulation. Well-characterized pharmacology. More appetite stimulation than Ipamorelin due to ghrelin receptor activation.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.