GLP-1(7-36) amide vs Ipamorelin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Ipamorelin (Growth Hormone Secretagogue) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Ipamorelin |
|---|---|---|
| Category | Endocrine Peptides | Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Growth Hormone Secretagogue |
| Molecular Weight | 3297.7 Da | 711.85 Da |
| Half-Life | 1-2 min | ~2 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 5 |
| Typical Dose | pM-nM physiologic range|research-dependent | 200-300 mcg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | SC |
| Purity | ≥98% | — |
| Studies Count | 99 | 156 |
| Research Status | Endogenous | Clinical Trials |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Ipamorelin Benefits
- ✓Stimulates natural GH release
- ✓Minimal cortisol/prolactin increase
- ✓Improved body composition
- ✓Enhanced recovery and sleep quality
- ✓Anti-aging effects
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Ipamorelin Dosing
Standard: 200-300 mcg SC 2-3 times daily|Pre-bed: 200 mcg SC 30 min before sleep|Combined: 100-200 mcg with CJC-1295 2-3x daily
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Ipamorelin Side Effects
- ⚠Common (Mild): Temporary tingling, water retention, increased appetite
- ⚠Rare: Headache, lightheadedness
- ⚠Very Well Tolerated overall
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ipamorelin
Ipamorelin has moderate clinical evidence. Phase II trials demonstrate selective GH release. Generally regarded as one of the safest GH secretagogues with minimal side effect profile.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.