GLP-1(7-36) amide vs PT-141
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and PT-141 (Bremelanotide (Melanocortin Receptor Agonist)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | PT-141 |
|---|---|---|
| Category | Endocrine Peptides | Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Bremelanotide (Melanocortin Receptor Agonist) |
| Molecular Weight | 3297.7 Da | 1,025.2 Da |
| Half-Life | 1-2 min | ~2.7 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 7 |
| Typical Dose | pM-nM physiologic range|research-dependent | 1.75 mg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | SC |
| Purity | ≥98% | — |
| Studies Count | 99 | 178 |
| Research Status | Endogenous | FDA Approved |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
PT-141 Benefits
- ✓Enhances sexual desire and arousal
- ✓Works through CNS (not vascular)
- ✓FDA-approved for HSDD
- ✓Effective for both men and women
- ✓Does not require sexual stimulation to work
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
PT-141 Dosing
Standard: 1.75 mg SC, 45 min before activity|Max frequency: Once every 24 hours|Max: 8 doses per month|Men (off-label): 1-2 mg SC as needed
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
PT-141 Side Effects
- ⚠Common: Nausea (40%), flushing, headache, injection site reactions
- ⚠Moderate: Elevated blood pressure (transient), fatigue
- ⚠Serious: Focal hyperpigmentation with repeated use
- ⚠Contraindications: Uncontrolled hypertension, cardiovascular disease
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
PT-141
PT-141 has robust clinical evidence including multiple Phase III trials. FDA-approved in 2019. Unique mechanism of action through melanocortin-4 receptors in the brain. Well-characterized safety and efficacy profile.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.