GLP-1(7-36) amide vs CJC-1295
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and CJC-1295 (Growth Hormone Releasing Hormone Analog) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | CJC-1295 |
|---|---|---|
| Category | Endocrine Peptides | Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Growth Hormone Releasing Hormone Analog |
| Molecular Weight | 3297.7 Da | 3,367.97 Da |
| Half-Life | 1-2 min | ~6-8 days (DAC) |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 30 |
| Typical Dose | pM-nM physiologic range|research-dependent | 1-2 mg/week |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | SC |
| Purity | ≥98% | — |
| Studies Count | 99 | 167 |
| Research Status | Endogenous | Clinical Trials |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
CJC-1295 Benefits
- ✓Sustained GH release over days
- ✓Improved body composition
- ✓Enhanced deep sleep quality
- ✓Accelerated recovery from training
- ✓Increased protein synthesis
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
CJC-1295 Dosing
Without DAC: 100-200 mcg SC 2-3 times daily|With DAC: 1-2 mg SC once or twice weekly|Combined with Ipamorelin: 100 mcg each, 2-3x daily
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
CJC-1295 Side Effects
- ⚠Common (Mild): Water retention, tingling/numbness, flushing
- ⚠Moderate: Joint stiffness, carpal tunnel-like symptoms
- ⚠Rare: Elevated blood sugar (transient)
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
CJC-1295
CJC-1295 has good pre-clinical and early clinical data. The DAC variant shows sustained GH elevation for days. Often combined with GHRPs for synergistic GH release.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.