GLP-1(7-36) amide vs hCG
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and hCG (Human Chorionic Gonadotropin) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | hCG |
|---|---|---|
| Category | Endocrine Peptides | Sexual Health |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Human Chorionic Gonadotropin |
| Molecular Weight | 3297.7 Da | 36,700 Da |
| Half-Life | 1-2 min | ~24-36 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 500-2,000 IU per dose |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous/Intramuscular |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 2000 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
hCG Benefits
- ✓stimulates endogenous testosterone
- ✓supports spermatogenesis
- ✓preserves testicular volume
- ✓may improve fertility markers
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
hCG Dosing
500-2,000 IU SC/IM 2-3x weekly|1,500-3,000 IU weekly in fertility protocols|titrate to testosterone, estradiol, and semen parameters
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
hCG Side Effects
- ⚠acne
- ⚠gynecomastia
- ⚠water retention
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
hCG
Human studies show hCG can raise intratesticular and serum testosterone by mimicking luteinizing hormone at the testis. It is commonly studied in male hypogonadism and fertility-preservation settings.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.