GLP-1(7-36) amide vs Hexarelin
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Hexarelin (Growth Hormone Releasing Hexapeptide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Hexarelin |
|---|---|---|
| Category | Endocrine Peptides | Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Growth Hormone Releasing Hexapeptide |
| Molecular Weight | 3297.7 Da | 887.04 Da |
| Half-Life | 1-2 min | ~70 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 6 |
| Typical Dose | pM-nM physiologic range|research-dependent | 100-200 mcg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | SC / IV |
| Purity | ≥98% | — |
| Studies Count | 99 | 198 |
| Research Status | Endogenous | Clinical Trials |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Hexarelin Benefits
- ✓Strongest GH pulse among GHRPs
- ✓Cardioprotective effects
- ✓Muscle mass and strength gains
- ✓Fat loss through improved body composition
- ✓Enhanced recovery from training
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Hexarelin Dosing
Standard: 100-200 mcg SC 2-3 times daily|Pre-workout: 100 mcg 30 min before training|Pre-bed: 100 mcg for overnight GH pulse|Cycle: 8-12 weeks then 4 week break (desensitization)
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Hexarelin Side Effects
- ⚠Common: Increased appetite, water retention, tingling
- ⚠Moderate: Cortisol and prolactin elevation (dose-dependent)
- ⚠Notable: Desensitization occurs after 4-16 weeks of continuous use
- ⚠Rare: Numbness in extremities
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Hexarelin
Hexarelin has extensive pre-clinical and clinical evidence. Multiple human studies confirm potent GH release. Unique cardioprotective properties are well-documented. Note that receptor desensitization limits long-term continuous use.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.