GLP-1(7-36) amide vs Follitropin alfa
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Follitropin alfa (Recombinant Human Follicle-Stimulating Hormone Alfa) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Follitropin alfa |
|---|---|---|
| Category | Endocrine Peptides | Sexual Health |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Recombinant Human Follicle-Stimulating Hormone Alfa |
| Molecular Weight | 3297.7 Da | 30,000 Da |
| Half-Life | 1-2 min | ~24 hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | 75-150 IU per dose |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Subcutaneous/Intramuscular |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 850 |
| Research Status | Endogenous | Clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Follitropin alfa Benefits
- ✓supports spermatogenesis
- ✓improves Sertoli cell signaling
- ✓may enhance sperm parameters
- ✓complements LH-driven testosterone support
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Follitropin alfa Dosing
75-150 IU SC/IM 2-3x weekly|adjust based on FSH and semen analysis|often combined with hCG in men
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Follitropin alfa Side Effects
- ⚠injection-site reactions
- ⚠headache
- ⚠bloating
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Follitropin alfa
Clinical literature supports follitropin alfa for male infertility, especially when combined with LH activity to optimize testicular output. Its role is strongest in hypogonadotropic hypogonadism and assisted reproduction protocols.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.