GLP-1(7-36) amide vs DSIP
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and DSIP (Delta Sleep-Inducing Peptide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | DSIP |
|---|---|---|
| Category | Endocrine Peptides | Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Delta Sleep-Inducing Peptide |
| Molecular Weight | 3297.7 Da | 848.8 Da |
| Half-Life | 1-2 min | ~15-25 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 9 |
| Typical Dose | pM-nM physiologic range|research-dependent | 100-200 mcg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | SC / IV / Intranasal |
| Purity | ≥98% | — |
| Studies Count | 99 | 74 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
DSIP Benefits
- ✓Promotes deep delta wave sleep
- ✓Normalizes disrupted sleep patterns
- ✓Reduces cortisol and stress response
- ✓Pain modulating effects
- ✓Antioxidant properties
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
DSIP Dosing
Standard: 100-200 mcg SC or IV, 30-60 min before bed|Cycle: 10-14 days, 5-7 days off|Chronic insomnia: 100 mcg daily for 2-3 weeks|Can be combined with Ipamorelin pre-bed
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
DSIP Side Effects
- ⚠Common (Mild): Morning grogginess initially, mild headache
- ⚠Rare: Vivid dreams, temporary appetite changes
- ⚠Generally very well tolerated
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
DSIP
DSIP has moderate clinical evidence from European studies. Human trials show improved sleep quality and normalized sleep-wake cycles. Also studied for alcohol and opiate withdrawal. Unique mechanism distinct from traditional sleep aids.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.