Bremelanotide vs GLP-1(7-36) amide
Head-to-head comparison of Bremelanotide (Bremelanotide (PT-141), cyclic melanocortin receptor agonist) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Bremelanotide | GLP-1(7-36) amide |
|---|---|---|
| Category | Sexual Health | Endocrine Peptides |
| Full Name | Bremelanotide (PT-141), cyclic melanocortin receptor agonist | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 1025.2 Da | 3297.7 Da |
| Half-Life | about 2.7 h | 1-2 min |
| Amino Acids | 7 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | 1.75 mg | pM-nM physiologic range|research-dependent |
| Route | Subcutaneous | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 200 | 99 |
| Research Status | Clinical | Endogenous |
Bremelanotide Benefits
- ✓increases sexual desire
- ✓supports arousal
- ✓may improve erectile response
- ✓on-demand use
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Bremelanotide Dosing
1.75 mg subcutaneous PRN|administer about 45 minutes before activity|max 1 dose per 24 hours
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Bremelanotide Side Effects
- ⚠nausea
- ⚠flushing
- ⚠headache
- ⚠transient blood pressure increase
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
Bremelanotide
Human studies and approval data support meaningful effects on sexual desire in women, with a central mechanism involving melanocortin signaling. It is one of the most clinically relevant peptides in this category and is commonly used as the reference compound for PT-141-type research.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.