Bremelanotide vs GLP-1(7-36) amide

Head-to-head comparison of Bremelanotide (Bremelanotide (PT-141), cyclic melanocortin receptor agonist) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.

PropertyBremelanotideGLP-1(7-36) amide
CategorySexual HealthEndocrine Peptides
Full NameBremelanotide (PT-141), cyclic melanocortin receptor agonistGlucagon-like peptide-1 (7-36) amide
Molecular Weight1025.2 Da3297.7 Da
Half-Lifeabout 2.7 h1-2 min
Amino Acids7HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Typical Dose1.75 mgpM-nM physiologic range|research-dependent
RouteSubcutaneousendogenous secretion|SC/IV in research/clinical analog studies
Purity≥98%≥98%
Studies Count20099
Research StatusClinicalEndogenous

Bremelanotide Benefits

  • increases sexual desire
  • supports arousal
  • may improve erectile response
  • on-demand use

GLP-1(7-36) amide Benefits

  • glucose-dependent insulin secretion
  • gastric emptying delay
  • satiety signaling

Bremelanotide Dosing

1.75 mg subcutaneous PRN|administer about 45 minutes before activity|max 1 dose per 24 hours

GLP-1(7-36) amide Dosing

physiologic secretion|research-dependent

Bremelanotide Side Effects

  • nausea
  • flushing
  • headache
  • transient blood pressure increase

GLP-1(7-36) amide Side Effects

  • nausea
  • fullness
  • reduced appetite

Research Overview

Bremelanotide

Human studies and approval data support meaningful effects on sexual desire in women, with a central mechanism involving melanocortin signaling. It is one of the most clinically relevant peptides in this category and is commonly used as the reference compound for PT-141-type research.

GLP-1(7-36) amide

One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

Bremelanotide stacks with:

Kisspeptin-54Melanotan-II

GLP-1(7-36) amide stacks with:

L-cellsinsulinsatiety
melanocortinlibidoerectile-functionapprovedgut-hormoneincretinendocrine-peptide