AICAR vs GLP-1(7-36) amide
Head-to-head comparison of AICAR (5-Aminoimidazole-4-carboxamide Ribonucleotide (Acadesine)) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | AICAR | GLP-1(7-36) amide |
|---|---|---|
| Category | Performance | Endocrine Peptides |
| Full Name | 5-Aminoimidazole-4-carboxamide Ribonucleotide (Acadesine) | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 338.21 g/mol | 3297.7 Da |
| Half-Life | ~2-3 hours | 1-2 min |
| Amino Acids | Nucleoside analog | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | — | pM-nM physiologic range|research-dependent |
| Route | — | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | >99% | ≥98% |
| Studies Count | 180 | 99 |
| Research Status | Active Research | Endogenous |
AICAR Benefits
- ✓Increases endurance capacity, enhances fatty acid oxidation, promotes mitochondrial biogenesis, improves glucose uptake, cardioprotective effects
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
AICAR Dosing
Research doses: 50-150 mg subcutaneously. Typically administered 30-60 minutes before physical activity in research settings.
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
AICAR Side Effects
- ⚠Potential hypoglycemia, lactic acidosis at high doses, injection site reactions. Banned by WADA as a metabolic modulator.
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
AICAR
Salk Institute researchers demonstrated AICAR could increase endurance in sedentary mice by 44% without exercise training. Activates AMPK, triggering PGC-1α expression, mitochondrial biogenesis, and enhanced fatty acid β-oxidation.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.