GLP-1(7-36) amide vs GHRP-2
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and GHRP-2 (Growth Hormone Releasing Peptide-2) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | GHRP-2 |
|---|---|---|
| Category | Endocrine Peptides | Performance |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Growth Hormone Releasing Peptide-2 |
| Molecular Weight | 3297.7 Da | 817.97 Da |
| Half-Life | 1-2 min | ~25 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 6 |
| Typical Dose | pM-nM physiologic range|research-dependent | 100-300 mcg |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | SC / IV |
| Purity | ≥98% | — |
| Studies Count | 99 | 172 |
| Research Status | Endogenous | Approved (Japan) |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
GHRP-2 Benefits
- ✓Potent GH release (stronger than GHRP-6)
- ✓Less appetite stimulation than GHRP-6
- ✓Improved body composition
- ✓Enhanced deep sleep quality
- ✓Cytoprotective properties
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
GHRP-2 Dosing
Standard: 100-300 mcg SC 2-3 times daily|Pre-bed: 100-200 mcg for GH pulse during sleep|Combined: 100 mcg with CJC-1295 for synergy|Cycle: 8-16 weeks, 4 weeks off
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
GHRP-2 Side Effects
- ⚠Common: Mild appetite increase, water retention, tingling
- ⚠Moderate: Cortisol elevation at higher doses
- ⚠Rare: Prolactin increase, transient dizziness
- ⚠Better tolerated than GHRP-6 overall
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
GHRP-2
GHRP-2 has strong clinical evidence. Approved in Japan for diagnostic use. Multiple human studies confirm reliable GH stimulation with a favorable side effect profile compared to GHRP-6.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.