Orexin-A vs GLP-1(7-36) amide
Head-to-head comparison of Orexin-A (Hypocretin-1 (Orexin-A)) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Orexin-A | GLP-1(7-36) amide |
|---|---|---|
| Category | Cognitive Enhancement | Endocrine Peptides |
| Full Name | Hypocretin-1 (Orexin-A) | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 3562 Da | 3297.7 Da |
| Half-Life | Minutes to <1 hour | 1-2 min |
| Amino Acids | 33 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | Research-only; no validated human dose | pM-nM physiologic range|research-dependent |
| Route | Intracerebroventricular/Intranasal | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 42 | 99 |
| Research Status | Pre-clinical | Endogenous |
Orexin-A Benefits
- ✓wakefulness
- ✓attention
- ✓memory consolidation
- ✓fatigue resistance
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Orexin-A Dosing
Research-only i.c.v. microgram/nanomolar studies|intranasal experimental use|no established human protocol
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Orexin-A Side Effects
- ⚠insomnia
- ⚠headache
- ⚠blood pressure changes
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
Orexin-A
Preclinical studies link orexin signaling to arousal, learning, and memory consolidation, making orexin-A a candidate for cognition-related research. It is not an approved cognitive enhancer and remains an experimental peptide.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.