Omentin-1 vs GLP-1(7-36) amide
Head-to-head comparison of Omentin-1 (Omentin-1 (Intelectin-1, ITLN1)) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Omentin-1 | GLP-1(7-36) amide |
|---|---|---|
| Category | Diabetes & Metabolic | Endocrine Peptides |
| Full Name | Omentin-1 (Intelectin-1, ITLN1) | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | ~35 kDa | 3297.7 Da |
| Half-Life | hours | 1-2 min |
| Amino Acids | 313 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | No approved human dose; research use only | pM-nM physiologic range|research-dependent |
| Route | IV|SC | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 82 | 99 |
| Research Status | Pre-clinical | Endogenous |
Omentin-1 Benefits
- ✓insulin sensitivity
- ✓glucose uptake
- ✓lipid handling
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Omentin-1 Dosing
not established|not established
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Omentin-1 Side Effects
- ⚠unknown
- ⚠immunogenicity risk
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
Omentin-1
Lower omentin-1 levels are often associated with obesity, insulin resistance, and metabolic syndrome. Research continues on its use as a biomarker and as a mechanistic lead for AMPK-linked metabolic interventions.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.