GLP-1(7-36) amide vs GLP-1
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and GLP-1 (Glucagon-like peptide-1 (7-36 amide)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | GLP-1 |
|---|---|---|
| Category | Endocrine Peptides | Diabetes & Metabolic |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Glucagon-like peptide-1 (7-36 amide) |
| Molecular Weight | 3297.7 Da | 3297 Da |
| Half-Life | 1-2 min | 1-2 minutes |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 30 |
| Typical Dose | pM-nM physiologic range|research-dependent | Research-only: 0.1-1.0 pmol/kg/min |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intravenous/Subcutaneous |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 1200 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
GLP-1 Benefits
- ✓beta-cell protection
- ✓improved insulin secretion
- ✓slower gastric emptying
- ✓lower postprandial glucose
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
GLP-1 Dosing
0.1-1.0 pmol/kg/min IV infusion in research|0.5-10 nM in vitro|continuous delivery in animal studies
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
GLP-1 Side Effects
- ⚠nausea at pharmacologic exposure
- ⚠tachyphylaxis with continuous exposure
- ⚠headache
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
GLP-1
Native GLP-1 has a very short half-life because of rapid DPP-4 cleavage, so it is mainly used as a mechanistic research peptide. Across animal and cellular studies it reduces beta-cell apoptosis, improves insulin gene expression, and enhances islet resilience.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.