Histatin-5 vs GLP-1(7-36) amide
Head-to-head comparison of Histatin-5 (Human histatin 5) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Histatin-5 | GLP-1(7-36) amide |
|---|---|---|
| Category | Dental & Oral | Endocrine Peptides |
| Full Name | Human histatin 5 | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 3035 Da | 3297.7 Da |
| Half-Life | minutes in saliva | 1-2 min |
| Amino Acids | 24 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | 1-100 µM in research formulations | pM-nM physiologic range|research-dependent |
| Route | Topical/Oral rinse | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 120 | 99 |
| Research Status | Pre-clinical | Endogenous |
Histatin-5 Benefits
- ✓anti-Candida activity
- ✓biofilm suppression
- ✓mucosal wound support
- ✓oral innate immunity
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Histatin-5 Dosing
topical rinse or gel|short contact exposure|repeat applications in research protocols
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Histatin-5 Side Effects
- ⚠local irritation
- ⚠proteolytic instability
- ⚠dose-dependent cytotoxicity in vitro
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
Histatin-5
Histatin-5 is a major salivary defense peptide that can kill Candida species and influence oral microbial communities. It is also investigated for wound-healing and xerostomia-associated oral infection models.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.