Histatin-5 vs GLP-1(7-36) amide

Head-to-head comparison of Histatin-5 (Human histatin 5) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.

PropertyHistatin-5GLP-1(7-36) amide
CategoryDental & OralEndocrine Peptides
Full NameHuman histatin 5Glucagon-like peptide-1 (7-36) amide
Molecular Weight3035 Da3297.7 Da
Half-Lifeminutes in saliva1-2 min
Amino Acids24HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Typical Dose1-100 µM in research formulationspM-nM physiologic range|research-dependent
RouteTopical/Oral rinseendogenous secretion|SC/IV in research/clinical analog studies
Purity≥98%≥98%
Studies Count12099
Research StatusPre-clinicalEndogenous

Histatin-5 Benefits

  • anti-Candida activity
  • biofilm suppression
  • mucosal wound support
  • oral innate immunity

GLP-1(7-36) amide Benefits

  • glucose-dependent insulin secretion
  • gastric emptying delay
  • satiety signaling

Histatin-5 Dosing

topical rinse or gel|short contact exposure|repeat applications in research protocols

GLP-1(7-36) amide Dosing

physiologic secretion|research-dependent

Histatin-5 Side Effects

  • local irritation
  • proteolytic instability
  • dose-dependent cytotoxicity in vitro

GLP-1(7-36) amide Side Effects

  • nausea
  • fullness
  • reduced appetite

Research Overview

Histatin-5

Histatin-5 is a major salivary defense peptide that can kill Candida species and influence oral microbial communities. It is also investigated for wound-healing and xerostomia-associated oral infection models.

GLP-1(7-36) amide

One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

Histatin-5 stacks with:

chlorhexidinefluoridexylitol

GLP-1(7-36) amide stacks with:

L-cellsinsulinsatiety
antimicrobial-peptidecandidasalivaoral-defensegut-hormoneincretinendocrine-peptide