GLP-1(7-36) amide vs Cholecystokinin-8
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Cholecystokinin-8 (Cholecystokinin (sulfated C-terminal octapeptide, CCK-8)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Cholecystokinin-8 |
|---|---|---|
| Category | Endocrine Peptides | Endocrine Peptides |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Cholecystokinin (sulfated C-terminal octapeptide, CCK-8) |
| Molecular Weight | 3297.7 Da | 1143.2 Da |
| Half-Life | 1-2 min | 1-2 min |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | DY(SO3H)MGWMDF-NH2 |
| Typical Dose | pM-nM physiologic range|research-dependent | physiologic low-picomolar-nanomolar range|research-dependent |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | endogenous secretion|research IV/SC |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 97 |
| Research Status | Endogenous | Endogenous |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Cholecystokinin-8 Benefits
- ✓gallbladder contraction
- ✓pancreatic enzyme release
- ✓satiety signaling
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Cholecystokinin-8 Dosing
physiologic secretion|research-dependent
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Cholecystokinin-8 Side Effects
- ⚠abdominal cramping
- ⚠nausea
- ⚠biliary contraction
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Cholecystokinin-8
CCK-8 is a canonical gut hormone fragment with extensive documentation in digestive physiology and appetite control. Sulfation of the tyrosine residue is important for high-affinity receptor activity.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.