GLP-1(7-36) amide vs Dendroaspis Natriuretic Peptide (DNP)
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and Dendroaspis Natriuretic Peptide (DNP) (Dendroaspis Natriuretic Peptide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | Dendroaspis Natriuretic Peptide (DNP) |
|---|---|---|
| Category | Endocrine Peptides | Endocrine Peptides |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Dendroaspis Natriuretic Peptide |
| Molecular Weight | 3297.7 Da | ~4300 Da |
| Half-Life | 1-2 min | 2-5 min |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | N/A (38-aa natriuretic peptide) |
| Typical Dose | pM-nM physiologic range|research-dependent | N/A |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | IV research |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 85 |
| Research Status | Endogenous | Endogenous |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Dendroaspis Natriuretic Peptide (DNP) Benefits
- ✓potent vasodilation
- ✓natriuresis
- ✓cGMP elevation
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Dendroaspis Natriuretic Peptide (DNP) Dosing
N/A|N/A
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Dendroaspis Natriuretic Peptide (DNP) Side Effects
- ⚠hypotension
- ⚠tachycardia
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Dendroaspis Natriuretic Peptide (DNP)
Real, documented natriuretic peptide family member that has been studied for receptor pharmacology and cardiovascular effects; of interest in translational natriuretic-peptide research.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.