GLP-1(7-36) amide vs C-Type Natriuretic Peptide (CNP-22)
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and C-Type Natriuretic Peptide (CNP-22) (Human C-Type Natriuretic Peptide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | C-Type Natriuretic Peptide (CNP-22) |
|---|---|---|
| Category | Endocrine Peptides | Endocrine Peptides |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Human C-Type Natriuretic Peptide |
| Molecular Weight | 3297.7 Da | ~2470 Da |
| Half-Life | 1-2 min | 2-3 min |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | SNNLGKQK...N/A |
| Typical Dose | pM-nM physiologic range|research-dependent | N/A |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | IV/SC research |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 85 |
| Research Status | Endogenous | Endogenous |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
C-Type Natriuretic Peptide (CNP-22) Benefits
- ✓cGMP signaling
- ✓vascular homeostasis
- ✓endochondral growth
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
C-Type Natriuretic Peptide (CNP-22) Dosing
N/A|N/A
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
C-Type Natriuretic Peptide (CNP-22) Side Effects
- ⚠hypotension
- ⚠headache
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
C-Type Natriuretic Peptide (CNP-22)
A real, well-documented natriuretic peptide with strong endocrine/paracrine roles; widely studied for vascular tone, bone growth, and receptor biology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.