Histatin-5 vs Statherin

Head-to-head comparison of Histatin-5 (Human histatin 5) and Statherin (Human statherin) — benefits, dosing, side effects, research data, and where to buy.

Research Score

PropertyHistatin-5Statherin
CategoryDental & OralDental & Oral
Full NameHuman histatin 5Human statherin
Molecular Weight3035 Da5380 Da
Half-Lifeminutes in salivaminutes to hours in saliva
Amino Acids2443
Typical Dose1-100 µM in research formulations1-50 µM in experimental systems
RouteTopical/Oral rinseTopical/Intraoral
Purity≥98%≥98%
Studies Count12095
Research StatusPre-clinicalPre-clinical

Histatin-5 Benefits

  • anti-Candida activity
  • biofilm suppression
  • mucosal wound support
  • oral innate immunity

Statherin Benefits

  • enamel pellicle stabilization
  • calcium phosphate homeostasis
  • remineralization support
  • anti-adhesion

Histatin-5 Dosing

topical rinse or gel|short contact exposure|repeat applications in research protocols

Statherin Dosing

topical peptide exposure in vitro or ex vivo|salivary-mimetic coating studies|surface-conditioning protocols

Histatin-5 Side Effects

  • local irritation
  • proteolytic instability
  • dose-dependent cytotoxicity in vitro

Statherin Side Effects

  • minimal systemic effects expected
  • surface adsorption variability
  • rapid enzymatic breakdown

Research Overview

Histatin-5

Histatin-5 is a major salivary defense peptide that can kill Candida species and influence oral microbial communities. It is also investigated for wound-healing and xerostomia-associated oral infection models.

Statherin

Statherin has been extensively studied as a key regulator of enamel mineral equilibrium and pellicle biology. It is used in biomimetic dentistry research to model or improve enamel protection and remineralization.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

Histatin-5 stacks with:

chlorhexidinefluoridexylitol

Statherin stacks with:

fluorideCPP-ACPhydroxyapatite
antimicrobial-peptidecandidasalivaoral-defensesalivary-peptideenamelpellicleremineralization