GLP-1(7-36) amide vs BDNF
Head-to-head comparison of GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) and BDNF (Brain-Derived Neurotrophic Factor (mature BDNF)) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | GLP-1(7-36) amide | BDNF |
|---|---|---|
| Category | Endocrine Peptides | Cognitive Enhancement |
| Full Name | Glucagon-like peptide-1 (7-36) amide | Brain-Derived Neurotrophic Factor (mature BDNF) |
| Molecular Weight | 3297.7 Da | 13,700 Da |
| Half-Life | 1-2 min | minutes to hours |
| Amino Acids | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | 119 aa |
| Typical Dose | pM-nM physiologic range|research-dependent | research-only microgram range |
| Route | endogenous secretion|SC/IV in research/clinical analog studies | Intranasal |
| Purity | ≥98% | ≥98% |
| Studies Count | 99 | 8000 |
| Research Status | Endogenous | Pre-clinical |
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
BDNF Benefits
- ✓neurogenesis
- ✓synaptogenesis
- ✓LTP support
- ✓neuronal survival
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
BDNF Dosing
0.1-1 µg local or intranasal research delivery|viral or protein infusion models|acute or repeated plasticity protocols
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
BDNF Side Effects
- ⚠off-target neuroexcitation
- ⚠headache-like effects
- ⚠unknown systemic protein effects
Research Overview
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
BDNF
BDNF is repeatedly associated with learning, long-term potentiation, and recovery from neurologic injury in preclinical literature. Direct protein delivery is difficult, so most studies focus on pathways that raise endogenous BDNF or on localized experimental administration.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.