Desmopressin vs GLP-1(7-36) amide
Head-to-head comparison of Desmopressin (1-Deamino-8-D-arginine vasopressin) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Desmopressin | GLP-1(7-36) amide |
|---|---|---|
| Category | Cognitive Enhancement | Endocrine Peptides |
| Full Name | 1-Deamino-8-D-arginine vasopressin | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 1069.22 Da | 3297.7 Da |
| Half-Life | 1.5-3 hours | 1-2 min |
| Amino Acids | 9 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | 10-40 mcg intranasal | pM-nM physiologic range|research-dependent |
| Route | Intranasal/Oral | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 35 | 99 |
| Research Status | Clinical | Endogenous |
Desmopressin Benefits
- ✓memory consolidation
- ✓reduced pressor burden
- ✓recall support
- ✓short-term learning
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Desmopressin Dosing
intranasal research dosing|10-40 mcg or IU-equivalent studies|single-dose protocols
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Desmopressin Side Effects
- ⚠hyponatremia
- ⚠headache
- ⚠nasal irritation
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
Desmopressin
The literature is mixed, but desmopressin has shown memory-related effects in selected populations and experimental paradigms. Its cognitive effects are usually discussed as a vasopressin-pathway probe rather than a primary nootropic.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.