Desmopressin vs GLP-1(7-36) amide

Head-to-head comparison of Desmopressin (1-Deamino-8-D-arginine vasopressin) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.

PropertyDesmopressinGLP-1(7-36) amide
CategoryCognitive EnhancementEndocrine Peptides
Full Name1-Deamino-8-D-arginine vasopressinGlucagon-like peptide-1 (7-36) amide
Molecular Weight1069.22 Da3297.7 Da
Half-Life1.5-3 hours1-2 min
Amino Acids9HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Typical Dose10-40 mcg intranasalpM-nM physiologic range|research-dependent
RouteIntranasal/Oralendogenous secretion|SC/IV in research/clinical analog studies
Purity≥98%≥98%
Studies Count3599
Research StatusClinicalEndogenous

Desmopressin Benefits

  • memory consolidation
  • reduced pressor burden
  • recall support
  • short-term learning

GLP-1(7-36) amide Benefits

  • glucose-dependent insulin secretion
  • gastric emptying delay
  • satiety signaling

Desmopressin Dosing

intranasal research dosing|10-40 mcg or IU-equivalent studies|single-dose protocols

GLP-1(7-36) amide Dosing

physiologic secretion|research-dependent

Desmopressin Side Effects

  • hyponatremia
  • headache
  • nasal irritation

GLP-1(7-36) amide Side Effects

  • nausea
  • fullness
  • reduced appetite

Research Overview

Desmopressin

The literature is mixed, but desmopressin has shown memory-related effects in selected populations and experimental paradigms. Its cognitive effects are usually discussed as a vasopressin-pathway probe rather than a primary nootropic.

GLP-1(7-36) amide

One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

Desmopressin stacks with:

arginine-vasopressinnoopeptgpe

GLP-1(7-36) amide stacks with:

L-cellsinsulinsatiety
vasopressin-analogmemorypeptidegut-hormoneincretinendocrine-peptide