MK-677 vs Statherin

Head-to-head comparison of MK-677 (Ibutamoren Mesylate (MK-677)) and Statherin (Human statherin) — benefits, dosing, side effects, research data, and where to buy.

Research Score

PropertyMK-677Statherin
CategoryGrowth HormoneDental & Oral
Full NameIbutamoren Mesylate (MK-677)Human statherin
Molecular Weight528.662 g/mol5380 Da
Half-Life~24 hoursminutes to hours in saliva
Amino AcidsNon-peptide compound43
Typical Dose1-50 µM in experimental systems
RouteTopical/Intraoral
Purity>99%≥98%
Studies Count12095
Research StatusActive ResearchPre-clinical

MK-677 Benefits

  • Oral GH secretagogue, 24-hour GH elevation, increases IGF-1, improves sleep quality, increases lean mass, does not suppress natural GH

Statherin Benefits

  • enamel pellicle stabilization
  • calcium phosphate homeostasis
  • remineralization support
  • anti-adhesion

MK-677 Dosing

10-25 mg orally once daily before bedtime. 25 mg is the most studied dose. Can be used long-term without cycling.

Statherin Dosing

topical peptide exposure in vitro or ex vivo|salivary-mimetic coating studies|surface-conditioning protocols

MK-677 Side Effects

  • Increased appetite, mild water retention, drowsiness, transient numbness, mild increase in fasting blood glucose with long-term use.

Statherin Side Effects

  • minimal systemic effects expected
  • surface adsorption variability
  • rapid enzymatic breakdown

Research Overview

MK-677

A landmark 2-year study in elderly adults demonstrated significant increases in lean mass, GH pulsatility, and IGF-1 to youthful ranges. Selectively agonizes GHS-R1a without increasing cortisol or prolactin.

Statherin

Statherin has been extensively studied as a key regulator of enamel mineral equilibrium and pellicle biology. It is used in biomimetic dentistry research to model or improve enamel protection and remineralization.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

MK-677 stacks with:

CJC-1295IpamorelinRAD-140

Statherin stacks with:

fluorideCPP-ACPhydroxyapatite
growth-hormone-secretagogueoralghrelin-mimeticIGF-1muscle-growthsleepsalivary-peptideenamelpellicleremineralization