Cholecystokinin-8 vs GLP-1(7-36) amide

Head-to-head comparison of Cholecystokinin-8 (Cholecystokinin (sulfated C-terminal octapeptide, CCK-8)) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.

PropertyCholecystokinin-8GLP-1(7-36) amide
CategoryEndocrine PeptidesEndocrine Peptides
Full NameCholecystokinin (sulfated C-terminal octapeptide, CCK-8)Glucagon-like peptide-1 (7-36) amide
Molecular Weight1143.2 Da3297.7 Da
Half-Life1-2 min1-2 min
Amino AcidsDY(SO3H)MGWMDF-NH2HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Typical Dosephysiologic low-picomolar-nanomolar range|research-dependentpM-nM physiologic range|research-dependent
Routeendogenous secretion|research IV/SCendogenous secretion|SC/IV in research/clinical analog studies
Purity≥98%≥98%
Studies Count9799
Research StatusEndogenousEndogenous

Cholecystokinin-8 Benefits

  • gallbladder contraction
  • pancreatic enzyme release
  • satiety signaling

GLP-1(7-36) amide Benefits

  • glucose-dependent insulin secretion
  • gastric emptying delay
  • satiety signaling

Cholecystokinin-8 Dosing

physiologic secretion|research-dependent

GLP-1(7-36) amide Dosing

physiologic secretion|research-dependent

Cholecystokinin-8 Side Effects

  • abdominal cramping
  • nausea
  • biliary contraction

GLP-1(7-36) amide Side Effects

  • nausea
  • fullness
  • reduced appetite

Research Overview

Cholecystokinin-8

CCK-8 is a canonical gut hormone fragment with extensive documentation in digestive physiology and appetite control. Sulfation of the tyrosine residue is important for high-affinity receptor activity.

GLP-1(7-36) amide

One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

Cholecystokinin-8 stacks with:

gallbladderpancreassatiety

GLP-1(7-36) amide stacks with:

L-cellsinsulinsatiety
gut-hormonesatiety-peptideendocrine-peptideincretin