Cholecystokinin-8 vs GLP-1(7-36) amide
Head-to-head comparison of Cholecystokinin-8 (Cholecystokinin (sulfated C-terminal octapeptide, CCK-8)) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Cholecystokinin-8 | GLP-1(7-36) amide |
|---|---|---|
| Category | Endocrine Peptides | Endocrine Peptides |
| Full Name | Cholecystokinin (sulfated C-terminal octapeptide, CCK-8) | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 1143.2 Da | 3297.7 Da |
| Half-Life | 1-2 min | 1-2 min |
| Amino Acids | DY(SO3H)MGWMDF-NH2 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | physiologic low-picomolar-nanomolar range|research-dependent | pM-nM physiologic range|research-dependent |
| Route | endogenous secretion|research IV/SC | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 97 | 99 |
| Research Status | Endogenous | Endogenous |
Cholecystokinin-8 Benefits
- ✓gallbladder contraction
- ✓pancreatic enzyme release
- ✓satiety signaling
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Cholecystokinin-8 Dosing
physiologic secretion|research-dependent
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Cholecystokinin-8 Side Effects
- ⚠abdominal cramping
- ⚠nausea
- ⚠biliary contraction
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
Cholecystokinin-8
CCK-8 is a canonical gut hormone fragment with extensive documentation in digestive physiology and appetite control. Sulfation of the tyrosine residue is important for high-affinity receptor activity.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.