Cholecystokinin-8 vs B-Type Natriuretic Peptide (BNP-32)
Head-to-head comparison of Cholecystokinin-8 (Cholecystokinin (sulfated C-terminal octapeptide, CCK-8)) and B-Type Natriuretic Peptide (BNP-32) (Human B-Type Natriuretic Peptide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Cholecystokinin-8 | B-Type Natriuretic Peptide (BNP-32) |
|---|---|---|
| Category | Endocrine Peptides | Endocrine Peptides |
| Full Name | Cholecystokinin (sulfated C-terminal octapeptide, CCK-8) | Human B-Type Natriuretic Peptide |
| Molecular Weight | 1143.2 Da | ~3465 Da |
| Half-Life | 1-2 min | ~20 min |
| Amino Acids | DY(SO3H)MGWMDF-NH2 | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Typical Dose | physiologic low-picomolar-nanomolar range|research-dependent | N/A |
| Route | endogenous secretion|research IV/SC | IV infusion |
| Purity | ≥98% | ≥98% |
| Studies Count | 97 | 85 |
| Research Status | Endogenous | Endogenous |
Cholecystokinin-8 Benefits
- ✓gallbladder contraction
- ✓pancreatic enzyme release
- ✓satiety signaling
B-Type Natriuretic Peptide (BNP-32) Benefits
- ✓natriuresis
- ✓vasodilation
- ✓biomarker
Cholecystokinin-8 Dosing
physiologic secretion|research-dependent
B-Type Natriuretic Peptide (BNP-32) Dosing
N/A|N/A
Cholecystokinin-8 Side Effects
- ⚠abdominal cramping
- ⚠nausea
- ⚠biliary contraction
B-Type Natriuretic Peptide (BNP-32) Side Effects
- ⚠hypotension
- ⚠flushing
Research Overview
Cholecystokinin-8
CCK-8 is a canonical gut hormone fragment with extensive documentation in digestive physiology and appetite control. Sulfation of the tyrosine residue is important for high-affinity receptor activity.
B-Type Natriuretic Peptide (BNP-32)
One of the best-characterized cardiac natriuretic peptides; widely used in diagnostics and cardiovascular research, including recombinant BNP-32 (nesiritide) studies.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.