Cholecystokinin-8 vs B-Type Natriuretic Peptide (BNP-32)

Head-to-head comparison of Cholecystokinin-8 (Cholecystokinin (sulfated C-terminal octapeptide, CCK-8)) and B-Type Natriuretic Peptide (BNP-32) (Human B-Type Natriuretic Peptide) — benefits, dosing, side effects, research data, and where to buy.

PropertyCholecystokinin-8B-Type Natriuretic Peptide (BNP-32)
CategoryEndocrine PeptidesEndocrine Peptides
Full NameCholecystokinin (sulfated C-terminal octapeptide, CCK-8)Human B-Type Natriuretic Peptide
Molecular Weight1143.2 Da~3465 Da
Half-Life1-2 min~20 min
Amino AcidsDY(SO3H)MGWMDF-NH2SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Typical Dosephysiologic low-picomolar-nanomolar range|research-dependentN/A
Routeendogenous secretion|research IV/SCIV infusion
Purity≥98%≥98%
Studies Count9785
Research StatusEndogenousEndogenous

Cholecystokinin-8 Benefits

  • gallbladder contraction
  • pancreatic enzyme release
  • satiety signaling

B-Type Natriuretic Peptide (BNP-32) Benefits

  • natriuresis
  • vasodilation
  • biomarker

Cholecystokinin-8 Dosing

physiologic secretion|research-dependent

B-Type Natriuretic Peptide (BNP-32) Dosing

N/A|N/A

Cholecystokinin-8 Side Effects

  • abdominal cramping
  • nausea
  • biliary contraction

B-Type Natriuretic Peptide (BNP-32) Side Effects

  • hypotension
  • flushing

Research Overview

Cholecystokinin-8

CCK-8 is a canonical gut hormone fragment with extensive documentation in digestive physiology and appetite control. Sulfation of the tyrosine residue is important for high-affinity receptor activity.

B-Type Natriuretic Peptide (BNP-32)

One of the best-characterized cardiac natriuretic peptides; widely used in diagnostics and cardiovascular research, including recombinant BNP-32 (nesiritide) studies.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

Cholecystokinin-8 stacks with:

gallbladderpancreassatiety

B-Type Natriuretic Peptide (BNP-32) stacks with:

NPPBnesiritide
gut-hormonesatiety-peptideendocrine-peptidenatriuretic-peptideventricularcGMP