hBD-1 vs GLP-1(7-36) amide
Head-to-head comparison of hBD-1 (Human beta-defensin 1) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | hBD-1 | GLP-1(7-36) amide |
|---|---|---|
| Category | Dental & Oral | Endocrine Peptides |
| Full Name | Human beta-defensin 1 | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 4490 Da | 3297.7 Da |
| Half-Life | minutes to hours | 1-2 min |
| Amino Acids | 36 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | 1-10 µg/mL in experimental studies | pM-nM physiologic range|research-dependent |
| Route | Topical/Intraoral | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 85 | 99 |
| Research Status | Pre-clinical | Endogenous |
hBD-1 Benefits
- ✓oral innate immunity
- ✓broad antimicrobial activity
- ✓biofilm suppression
- ✓periodontal support
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
hBD-1 Dosing
topical peptide exposure|cell-culture or mucosal models|repeat low-dose application in research
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
hBD-1 Side Effects
- ⚠protease degradation
- ⚠local irritation at high dose
- ⚠limited stability in saliva
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
hBD-1
hBD-1 has been studied as part of the oral mucosal defense system and is linked to host resistance against dental pathogens. Research spans periodontitis, candidiasis, and epithelial barrier biology.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.