C-peptide vs hGHRH(1-40)OH

Head-to-head comparison of C-peptide (Connecting peptide (C-peptide)) and hGHRH(1-40)OH (Human growth hormone-releasing factor (1-40) hydroxyl) — benefits, dosing, side effects, research data, and where to buy.

Research Score

PropertyC-peptidehGHRH(1-40)OH
CategoryPain ManagementGrowth Hormone
Full NameConnecting peptide (C-peptide)Human growth hormone-releasing factor (1-40) hydroxyl
Molecular Weight3020.3 DaN/A
Half-Life~20-30 min5-20 minutes
Amino Acids3140
Typical Doseno approved analgesic dose|research-only1-2 mcg/kg
RouteIV|subQSubcutaneous/IV
Purity≥98%≥98%
Studies Count4685
Research StatusPre-clinicalClinical Research

C-peptide Benefits

  • diabetic neuropathy research
  • nerve function support
  • possible analgesic effect

hGHRH(1-40)OH Benefits

  • GH secretion research
  • fragment-activity comparison
  • receptor binding studies
  • axis physiology modeling

C-peptide Dosing

0.5-1.0 mg/day in research|route varies by protocol

hGHRH(1-40)OH Dosing

1-2 mcg/kg SC or IV in acute research settings|single-bolus GH stimulation protocols|repeated low-dose administration in comparative studies

C-peptide Side Effects

  • injection-site reactions
  • unknown long-term safety

hGHRH(1-40)OH Side Effects

  • flushing
  • headache
  • lightheadedness

Research Overview

C-peptide

C-peptide is not an approved analgesic, but multiple studies have examined its effects on peripheral nerve blood flow and neuropathy outcomes. The strongest relevance is in diabetic neuropathic pain rather than migraine.

hGHRH(1-40)OH

Human GHRF(1-40)OH has been studied to understand how truncation of the native hormone changes biological potency and half-life. It is a common research tool for mapping minimal active sequences within the GHRH family.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

C-peptide stacks with:

C-peptideConnecting peptide

hGHRH(1-40)OH stacks with:

L-arginineL-ornithineglycine
neuropathic-paindiabetic-neuropathynerve-repairghrhfragmentpituitaryresearch-peptide